PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do019744.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 139aa    MW: 14901 Da    PI: 9.3858
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do019744.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof82.35.2e-2682127449
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnv 49 
                 + l+cpr  s++tkfCy+nny++ qPr++C+ CrryW +GGalr v
  Do019744.1  82 EPLPCPRWGSRETKFCYFNNYNVRQPRHLCRVCRRYWMAGGALRRV 127
                 6789****************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-1982127IPR003851Zinc finger, Dof-type
PfamPF027011.2E-2283127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088421.34384138IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MANLPDADAA GFKLFGKVIQ PPDAHHRATE EGGASTSPPP ALPLATATPE AVLPPAAPPQ  60
SPPLPTLSLQ QAAGAGAGGP GEPLPCPRWG SRETKFCYFN NYNVRQPRHL CRVCRRYWMA  120
GGALRRVGEI VFSELNRHR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0616553e-50BT061655.1 Zea mays full-length cDNA clone ZM_BFb0169J01 mRNA, complete cds.
GenBankEU9546093e-50EU954609.1 Zea mays clone 1473007 hypothetical protein mRNA, complete cds.
GenBankEU9770913e-50EU977091.1 Zea mays clone 998767 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456120.11e-40hypothetical protein SORBIDRAFT_03g030850
TrEMBLE6PBM05e-41E6PBM0_SORBI; Dof-type zinc finger protein 13
STRINGSb03g030850.14e-40(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147161620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.14e-21Dof family protein